SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a003209m|PACid:17669830 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a003209m|PACid:17669830
Domain Number - Region: 381-490
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00602
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a003209m|PACid:17669830
Sequence length 600
Sequence
MAKKKVSQSHQEKPLQKQDDSVKAAANQEVSPPMDSEASEKLESLKSLNQILVKESFERR
QQVESLVQSKASLESELTRSNSDKEGLMSELTRLGETAAALELERSVVAVFVAEQVAQNG
EVFEREVKGLESELKGLRGVIGEKESEIGSLTEKLSEIEGELGNERAVLKGVCVERDEIK
GKLDLQIDESKGLKANLIEFEEKNRVMERAIGELRSTYNAVLGEKEEREMRIESILREKD
SIERSLVESNKLAENLKEELSGVVREKEGIEEEKNAEIIKRQELENADMVREITQLVEEK
KSSEERIEGLTDEKTAIGKDLKEALEQLAEQKLKIEEMVNEKIVVLEAKDTLDSEVRELQ
NQVLELKAVVSKLEENNRAEAEKIKNLDSEVGEYKSKLEEVKIKRDEMQKIIQEEKKNGV
RLNEKITELENKVEESLKAYEELKAKNGSIFAEKVELESKCEKLKKGISSLENTIIEARN
EFDSMKVKFESADANSELVMSMLKDTVAFCSKGEADVAAVDGVVIGNKNGGESKGCVVEL
EMIKNAFKSKMTKVETMKRQMELLQNSVEDAHKKKSFWTVLSSATTLLAAISLAYVARGH
Download sequence
Identical sequences A0A022PYL1
mgv1a003209m|PACid:17669830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]