SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a003261m|PACid:17677514 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003261m|PACid:17677514
Domain Number 1 Region: 346-493
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000497
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a003261m|PACid:17677514
Sequence length 596
Sequence
MDKRKWLWKRRSSERSPGESESSGSFSSHSERYSDEQEALRESPNDSQQSPEVTSKSTIT
EQVKESVKSLTEKLSAALVNVSAKEDLVKQHAKVAEEAVAGWEKAENEVAALKQQLEVAV
QQNLNLEVRASHLDGALKECVRELRQAKDEQEKRISDALSEKNTEWESTKSELEKQILDL
KLQVEASRSQNSASIVEGLKKENSSLKKDLVSCYEELEIMTIERDLSTRAAETASKVQLE
SIKKIAKLESECRKLQTISRKSSPSNNQKPSFYPESLTDSHSDKDINGSERSFSELDQFK
TVVIKPSVEIDMMDDFLEMERLVALPETKSSSPVSGESISVDDRLRTELDSMTQRVAELE
DRLEKIESEKLELENILERTVDSLKDAQARSEETETKLEELQQEMNAVNETKELLEFQLV
DMEVEARTMSANVDSLKAEIEEERKLSAEMKVRCRELENELARTIQEIEIEHNNNSNSEL
KIKQEDLAVAADKLAECQKTIASLGRQLQSLATLEDFLIDSSNIPGLSTKNMLTPKSDLD
RPRMSADNYSLLTNGNEDLSLSPLSTNHITTGKNRSSFGKFFSRSKSVREIENSRD
Download sequence
Identical sequences A0A022QBK1
XP_012853448.1.32330 mgv1a003261m|PACid:17677514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]