SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a003826m|PACid:17690871 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003826m|PACid:17690871
Domain Number 1 Region: 279-480
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000948
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a003826m|PACid:17690871
Sequence length 561
Sequence
MASNIVKSNKMKRMESKKTYSWWWDSHVSPKNSKWLQDNLEDMDQHVKRMLKLIEEDADS
FAKKAEMYYQKRPELISLVEDFYRMYRSLAERYDHVTGELKKNIPSDLQSQCSGISDLGS
EPPSAMASPDRRPLSQRKSGPRAAGFEFFLGNGGGPGSDICSMESESESDDEEDSSVNNY
SGNDEEQGLRTKIIELEVELREVKEKLQSREVADISEGHFGQFSDEKKGKYEEQLRVAKE
EIGRLTIELRKYASVEDNTEVEQNQESVMDGSEGEVVDSVDKIQTLEEELRITQDKLRDS
EEEITRLRQELTSKGSSIENLQDELKMAEKELEKEKREVLKLQERVTRYKTNLSDRDQEI
RVLKEAMSNANKTLSEENEQLRSEITRISKERASLEDNLKELDFRCQSLQEDVRRKAEAE
VVFGSQIDDLKADLAEKNEIIEGLKKNIEDLNTKIDALVVEVSSKDDHIDEMNKHLHQLH
MEHVDLIGGAEVARKSIEELRWRIKELEREVEKKEEIIIEGAEEKREAIRQLCFSLEHYR
NGYHRLRQAVVGHKGLPVIAS
Download sequence
Identical sequences A0A022RZS9
XP_012842269.1.32330 mgv1a003826m|PACid:17690871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]