SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004119m|PACid:17670980 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a004119m|PACid:17670980
Domain Number - Region: 73-124
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 0.034
Family ENV polyprotein, receptor-binding domain 0.0066
Further Details:      
 
Domain Number - Region: 378-528
Classification Level Classification E-value
Superfamily Tropomyosin 0.0817
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a004119m|PACid:17670980
Sequence length 543
Sequence
MKGMWSDHFAAADKPSEESSPPCKTHGLWSEIFPSADESTPPPPPHHETCSAAVEPPPLS
RYEMFSPAAPPLPRYERCLICPKCNAASCRLLTSSTTQNPGRRFYICPAPANNVGLGEGS
CGYKVWKDELEVSSTTQADVRTCSFRSTLSNSNSSTSPVSIDQIDEVADYDSPVIDNSPS
NTIEQLQSDKPSGSLRRANKRSRYGDLEAHSLTIRLEILDQWRNARSDMNSVSIEHCWKK
AAVRQNLSSELLGWWGRLAFHPKPCLSTHPSKPFARYVSSPLESSSAVEDGTLVNSGDSI
TLTRNLLGFEPPLLNPDQENELSRIKPICVTPNTKPDNFMSKSISKAFSEAAEHLQNDLL
TLLENMDVKEHEAMTEAAEATFAALDRLLINHQEFKKRANEFIHCAMLLSEIEQSMPEND
SYQKLAEHCTAEKTRLDEINCVHTEVVDNVTSSKKRLKLAQEEISSTMDLLFQIEAELSC
CEVELKNMEHELEKISEKKEVLEGNYTIASKELESSLKLREKKEADRNAAKAAFNTARAL
LRG
Download sequence
Identical sequences A0A022Q5R1
mgv1a004119m|PACid:17670980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]