SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004254m|PACid:17683912 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a004254m|PACid:17683912
Domain Number 1 Region: 279-484
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000196
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a004254m|PACid:17683912
Sequence length 537
Sequence
MDSDNIQDRSSSVENASSGEAEAESNYNDSLEVVSSGGATIRELDSIAEMLTRVELDLAC
SSEKLVNLDILVMHVASRENDFEAFALEDEHTSDGRAEKALEFDLLYGFLDSEVTELESL
LSALQAEIVRSKGSISSFKQLGDGLKEIEEKLQDCEDTLKISFEQVSGIKMQSANFRKIL
LASSGDGKWNDENEFAGPENGGHSDINAKIKMQTSEQQRNILRMLEKSLAREMDTEKKLT
ESRQTEEDLKFRLQHEVYCMEVEGEDMLEKLLEAENSAEIFLGISKELFGRIQAAQFSIN
ESIQREQELRSKLQDFTEQLKEKDCALQSSENSRAELVEKVNSLEEKLGDFESQLHNVKE
SSEQNKELNGKVTEVEMRAEIAEAECKILRESNMKLNMEVSRLKSSNDDATARVEQLEKR
LKDSEMKQVHAKASAEASQEKQSMLEQTTKDMDNLIKDLKSKVLKAENQTESAEEKCIIL
SEQRSFKTEIKTDLTDSTSELNNTVRNIDTRQLKFKYVFIAVLVLAIPAFAAFLFQH
Download sequence
Identical sequences A0A022RWB4
mgv1a004254m|PACid:17683912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]