SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004285m|PACid:17691015 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a004285m|PACid:17691015
Domain Number - Region: 316-370
Classification Level Classification E-value
Superfamily Tropomyosin 0.0399
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a004285m|PACid:17691015
Sequence length 535
Sequence
MNEQPKMMNQQHQMNLNPNMMSMSQMNPQQQQQPQMLPMNRSFGIWPPPPQFQNPNPNPG
AMKPPSSAFKKPLGPRSNWKGKRVNKPNDKRRNEQQKPLNPGPSGGGIAGSVNIVGGLGG
VGNLNFNNYQPPTLVDLQQQNRLKTRKFFPKKKFNNKNINMGMNMNMNMGANNNNNNNNN
NNYNNSRSAPFAPRNTTSFLIRAKKSGGIASLVSPSPMTPAVLPTPIFSPSREVLVDMAK
EEWGVDGYGSMKGLIRLRSPGHDMEGHEDEDEDEGGSSESDVEEHVEVERRLDHDLSRFE
MIYNPNNINVSGMEYHNVLENRVDDQDTHIAQLEDENLILKERLFLMERELGDLRRRMQL
LERRGNRGGEEINEEVVENDSENESGSRGEEGAHSMEDNNDGFSGDNEVRVDGQDSEDKS
DVSGSEKKAHNNDDAPAESDKNVDVTDFEQEDKKGGFIEESKDEETKKDREENGNCGGED
ECVDMVKATDNSGTESCETVVVGRDVCMEDVGVAKDETVSRRDVANSSVTEVNES
Download sequence
Identical sequences A0A022S325
XP_012830147.1.32330 mgv1a004285m|PACid:17691015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]