SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004468m|PACid:17680378 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a004468m|PACid:17680378
Domain Number - Region: 7-86
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a004468m|PACid:17680378
Sequence length 525
Sequence
MLDKLQRRQSNDSSLTMLSNSLPPKIQQMKELLSELEMVENEITRLECQISQLKSEEKHE
KESHVEYSKAKRTLDYNNNDHHESNEKVAFDIKALHFITKAIKGDYKEKCTNNSSKRFST
RNRKEDENVPFQEKVLRRNGTVKPSSPSTEPRHPTPWLDIKFPSTPLHTEEENIQRWSPN
KLSENIMKCLVFIFVRLLRTSRAIELEKSGPIIRASSSFSLSFRAEASSNSKTGPAFQKE
SRQRDPYGIFDCEGSIPRDIGPYKNLVRFTSSSVDAKCIKNSSYVPLFQKLKVLMDGLRR
VDLRFLSHRQKLAFWINMYNACIMHGFLQYGVPSVSSPEKLLTLINKATLTIAGSSINAH
AIERFILRKPSDSPDKEIMGKGGKDNKQMLVHQLYGLETPDPNIVFALCCGTRSSPAVKI
YTAEGVTGELERSKLEYLQAAIMVKSNKRIGIPELVLKNRHDFADHDVDSLMEWLCRQLP
TSGTLRKSIVDCFRGRRGGGGGDKAYSVVVENIPYEFEFQYLLAI
Download sequence
Identical sequences A0A022R8V8
mgv1a004468m|PACid:17680378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]