SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004629m|PACid:17669789 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a004629m|PACid:17669789
Domain Number - Region: 168-303
Classification Level Classification E-value
Superfamily Tropomyosin 0.000275
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a004629m|PACid:17669789
Sequence length 517
Sequence
MEKMRQWGSDSGGGGSPVRGHHARASSVSGISTIKRNQNFAAKAAAQRLAQVMASQSAAD
DDDDDDDIGDSDGDLGLRFNPPLPLSFSRPPINTNGVKPLVPPPKILRSSSDAVTRNLLD
DALPARSTSTGRPSMSIRTTPAVPPSIPSLKTPAPIPPIVPPNNRQREKKFSPDFGQLNF
KDAGDGRSSSALRDELDMLQEENENVLEKLQLAEESCVAAEARVRELEKQVASLGEGVSL
EAKLLSRKEAALRQREAALKEAKLAKDGVDVDLSSLQSDVKIAKAEAATTFEQLRETESE
VKEEVVLKRCWLARYWGLAAQYGICADIASAKHEYWSSLAPLPLEIVLSAGQKAKEESKL
VDDFNDLTGDGNIESMLTVEMGLKELASLKVEESMVLAFAQQRRPNSSRTSMPDFKSPID
PKYMEAFELSPEESEDVLFKEAWLMYFWRRAKAYGIEEEIANERLKFWIGRSGQSPTSHD
AVDVEQGLMEIRKLGIKQRLWEASRKEIEQDTSLLNG
Download sequence
Identical sequences A0A022RCB2
mgv1a004629m|PACid:17669789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]