SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004843m|PACid:17688174 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a004843m|PACid:17688174
Domain Number 1 Region: 14-274
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.05e-45
Family Galactose oxidase, central domain 0.01
Further Details:      
 
Weak hits

Sequence:  mgv1a004843m|PACid:17688174
Domain Number - Region: 393-487
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000288
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a004843m|PACid:17688174
Sequence length 507
Sequence
MGTNSQSWYKELNYDEWVALPVSGQRPAARYKHAATVLDENLYVTGGSRNGRYLSDFQVF
DLKNLTWSTIKVNMEANDVESKGGSRLEVFPAISGHSMIKWGKRLLLLAGLSKNMSDRVT
VRFIDPESHNCIVVETFGNVPVARSGQSVTLFGSKLIMFGGEDWNRRLLNDVHVLDLETM
TWSAIETTQTPPAPRFDHIAALHAERYLFIFGGCSHSVFFNDIHVLDLETMEWSQPQMQG
DLVNARAGHAGVVVDGNWFVVGGGDNKSGALETVVINMSKLVVSVLTSVKGRDPLASEGI
SISSASLGGESFLVTFGGYNGKYYNEVFVMRVKPRDSLHPKILQSPAAAAAAASVTAAFA
IANPETVDFADKEDSNSKVIPVDTYQQNLSAEIDSIREEKKALELSLSEFTAETSALRTK
LEEANGNYAELSKELHSVQGQLAAERSRCTKLEAQIGELRKMLESMPSLEQEVQALRTEK
SAFERDIEISTQVQRQRSGGIWKWATG
Download sequence
Identical sequences A0A022QY11
XP_012843325.1.32330 XP_012843327.1.32330 mgv1a004843m|PACid:17688174 mgv1a004856m|PACid:17688173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]