SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004905m|PACid:17683686 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a004905m|PACid:17683686
Domain Number 1 Region: 398-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000085
Family Motor proteins 0.0017
Further Details:      
 
Weak hits

Sequence:  mgv1a004905m|PACid:17683686
Domain Number - Region: 276-420
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000915
Family HBL-like 0.012
Further Details:      
 
Domain Number - Region: 206-317
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00314
Family Myosin rod fragments 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a004905m|PACid:17683686
Sequence length 505
Sequence
MASKNQNKAPSSPQSKYSVDEVSVDKRRRIGNAKMPPYGGTRMQTRQAFSVVNGGQDLPP
TTAPPSHSGSEGGIVEFSKEDIDALLNEKLRIKNKFNFKDKSELMGDYIKRLKQCIKWFQ
QLEGNYVSEQEKLKNLLDAVEKKCNDMESMMKAKEDELNSIIMELRKHLEALQEKFAKEE
ADKLEALDSLGREKDSRLEAERLQASLSEELKRTQQDNATANQKIQSFNDMHKRSQEYTI
SLQQYNSRLQSELHATNDTLKRVEKEKAAVVENLSTLRGHYTSLQEQLTSSRETQAEVIK
QKEALGSEVTCLRGDLQQVRDDRDRRLLQVQALSDEVEKYKECTGKSIAELESLTSKTNN
LESTCSSQSEQIRRLQEQLAFAEQKLQKSNISIMTTRSEFEEQQAMIRELKNRLTDADSK
ILEGEKLRKQLHNTILELKGNIRVFCRVRPLLSDDGVGNDAKVVSFPTSMEMLGRGIDLA
QNGQKHSFTYDKVFMPDDSQQDVFV
Download sequence
Identical sequences A0A022R0Y1
mgv1a004905m|PACid:17683686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]