SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004985m|PACid:17693148 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a004985m|PACid:17693148
Domain Number - Region: 443-488
Classification Level Classification E-value
Superfamily UBA-like 0.00766
Family UBA domain 0.021
Further Details:      
 
Domain Number - Region: 84-165
Classification Level Classification E-value
Superfamily Tropomyosin 0.0118
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a004985m|PACid:17693148
Sequence length 501
Sequence
MPIRPAVGSSSPKAARPSNFDSGDDDAPLRTWNSLDSRPGASPIRNYNSIDADEPAKFVL
GNNHKPSNASLDASLVSEIDKTMKKYMDNLTHAVDNMSARLSQLETRTRNLEHSIDDLKV
SVGNNHGITDGKMRLLENILNEVQAGVELIRDKQEVVEAQVQIAKMLNPKVEQVESKNTA
HMDSTQTGVPTHQQYSTVSPAQPPPPNAPPPPPPQHNLQPQVQFPNQFPQNQPPSIPQRE
SYFPSPGQTPENPNQQYQLPPPPPPLQLQQHHPGAPPSQLQYSQQPPPPQPQYSQPPPPP
SQPHPSFPPANPSLPQQPIGNHLPEESMYAPPQTYPSGIRPPPPSQQYYSPTNVYEPPSN
KPALGYSSSFGPSSGHGDPYPYSSSPSKYGGNNSPVKAQHMGQSGGSGYPQLPTARVLPQ
ALPAAAAVGGGGGGGSGSGSGGSGNRVPIDDVVDRVTNMGFPRDQVRATVKKLTENGQAV
DLNIVLDKLMNDGDGRNWFGR
Download sequence
Identical sequences A0A022S0L8
mgv1a004985m|PACid:17693148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]