SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a005418m|PACid:17674502 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a005418m|PACid:17674502
Domain Number - Region: 422-475
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00706
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a005418m|PACid:17674502
Sequence length 484
Sequence
MEGRSYSEFYRNTSEELFIKTMMESSIGMPAPTMEMLGFKNLAQNLRADSEELFKSWLTN
GEASKKNSSSFIGHRPRQASRRISTELASLANQTGVALQKKTNDDFIFPQTTPTAVDSSN
DLVSTRTVGENGLQGSNRFLAKAWFHSSHPMTRSRSSELRKKYVAMQNSQTPIGIEAMHE
ASENGVVNNFRHEPVNPNGFINNNTNISLYDSAFMSPSNSSSSAFTDPQIGSMDKISSVV
SMLKGTLERKKLVNNQAMENTCFDNYYNNNNNNHGDQEIHAYENGGNFQDLSTLGVLQTI
EESLLEGIIVGPTQMNTISREPSQSESSAQALSVCESSMNQMGGGGTEDYSRTKDYRERT
YDNSIEDQKKGGLIRYGSVTSAGSVERGDPTKKRRVERSRKMAEAKGRSSTPTVPSDMQS
VLKRCENLEKEVRSLKLNLSFMNRKDSEQTKQIEELQKQNQDLGDEKERLLEEIERIIAE
TGKM
Download sequence
Identical sequences A0A022QMC6
mgv1a005418m|PACid:17674502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]