SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a006416m|PACid:17678997 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a006416m|PACid:17678997
Domain Number - Region: 262-343
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00602
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 122-172
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0275
Family Troponin I 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a006416m|PACid:17678997
Sequence length 444
Sequence
MKARHESLGRRTLEDIRQKRAAERLSKTVSGPDLGKDPIDGLGIKKSESTNRLSENDISG
LVLQLKDIHQRNVELEDANAELTSLLKKKEVEDDMLQKRLSDLEQNTVPSLRKALKDVAM
EKDAAVVAREDLSAQIRTLKKRMKEAEEEQYRAEEDAAALRAELNSLHQQAMSNTPAAIN
ATGYSVDQMQAMEKELSNLRSKLQQESILRQQEHQQLAEEQARNSDLIIQKQELEEKLAS
ASEAALESKIDQANHKTLTLDDKEKLEKQLHDMAVAVERLESSRQKLLMEIDSQSSEIER
LFEENSSLSSAYHESTGLVAHWENQVKVCLQQNEELRNMLDKLRMEKASVAGINDKASQA
LLDSGRVDNLIEPQYAAEFYSIKSELAKEQSRAESLSAEVLQLSARLQRATQAYNGLARL
YKPVLRNIENGLMKMKQDGSLSVQ
Download sequence
Identical sequences A0A022REP9
XP_012835940.1.32330 mgv1a006416m|PACid:17678997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]