SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a006440m|PACid:17684124 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a006440m|PACid:17684124
Domain Number 1 Region: 194-370
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00000000000366
Family Apolipoprotein A-I 0.017
Further Details:      
 
Weak hits

Sequence:  mgv1a006440m|PACid:17684124
Domain Number - Region: 91-202
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a006440m|PACid:17684124
Sequence length 444
Sequence
MAALKLFIVTVFLSLFLAGIGVNADASLSDADGKPRSDGPDSAVLEQLKSKIHTLENHIE
EKTREIKNKDEVIASKEKIIKEKSDGIVSLESEIASLQKKGKLDATEKLEQAYARADELE
KKVEKLIEDLNVKIKEKEQLEARVIEAEKKASEMSSKADKLQKIIDDQKTKLRKTERALH
IAEEEMMKSKFEATTKAKELMEVHGAWFPHWLAVHCTHYQSVLEKKWEAHGKPAVEVLVQ
KAIEKKAQAGKWAAPHVETVKTKWVPAIKEQWVVIASNVEPHVQMLTTKSIEVYGASKDA
LAPHITKVVVFVDPYFQELRKVTKPYIDQVATASRPHVDKLHSAVKPYTQHAVHAYGKFL
ESATTYHHQVQHKVQEKLKSHELTNPLATKELVWFAASALLALPVIFLIKIFSAIFCKKT
QKRTRNGNPGRSRRKVKHVHHAEK
Download sequence
Identical sequences A0A022QNI7
mgv1a006429m|PACid:17684123 mgv1a006440m|PACid:17684124 XP_012847132.1.32330 XP_012847134.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]