SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a006728m|PACid:17684472 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a006728m|PACid:17684472
Domain Number 1 Region: 164-363
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000844
Family Glycogenin 0.052
Further Details:      
 
Weak hits

Sequence:  mgv1a006728m|PACid:17684472
Domain Number - Region: 70-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.0288
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a006728m|PACid:17684472
Sequence length 433
Sequence
MIGVRRESGLMKKDGGDGFKSLRGSRIAAAIFVGLLVGCVFAFFYPDGFFVIHHQVATSD
SEVVTSSCETSERINILKSEFVSASEKNAELKRQIRGLTEKLRLAEQGKDNAQKEVLVLG
EQQKAGPFGTVKASRTNPTVIPDESANPRLAKILEKVAVNRELIVTLANSNVKDALEVWY
TNIKKVGISNYLVFALDKEIATLCEANDVPFYRKLETDTSFDSVAKTGGNHAVSGLKFRI
LREFLQLGYSVLLSDVDIVYLQNPFDYLYRDSDVESMTDGHDNMTAYGFNDVFDEPAMGW
ARYAHTMRIWVYNSGFFYIRPTLPSIELLDRVANRLARENAWDQAVFNEELFFPSHPGYE
GLHASRRTMDYYMFMNSKTLFKTVRKDSNLRKLKPVIIHVNYHPDKLERMKGVVDYYVNG
KKDALDSFPDGSE
Download sequence
Identical sequences A0A022RBY6
mgv1a006728m|PACid:17684472 XP_012837022.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]