SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a006911m|PACid:17678486 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a006911m|PACid:17678486
Domain Number 1 Region: 14-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-34
Family Heat-shock transcription factor 0.00078
Further Details:      
 
Weak hits

Sequence:  mgv1a006911m|PACid:17678486
Domain Number - Region: 120-195
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00178
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a006911m|PACid:17678486
Sequence length 426
Sequence
MDGGAPGGGGGGGGPAPFLLKTYEMVDDTATDAIVSWSASRKSFVVWNPPEFARVLLPSY
FKHNNFSSFIRQLNTYGFRKIDPEKWEFANEDFTKDQKHLLKNIHRRKPIHSHSQPQGSV
DSERASFEEEIDKLSRDKSVLEGKLSGYKEQQSAAKSQLETLTPRIVSMEQRQEKLLSFL
EKAVQNPDFVDRLTQKLESMDFSVYNKKRRLPQSDHVQSIQDNLLLDDQLGSICDQDLCN
ELRLELSTAVSDVNLLSHSTQSSNEGLSKDVHVRTSSGFLCPPETLELSDTGASFKLGPE
SPKRQSLQDEGDVHLSCLLNLTLASSSSPLELDKNREICTRSDNEVVHTQTVASSHDVNN
SKQGGSNGQNRVNDVFWEQFLTERPGCSDTEEGSSGFRAKPYEEQEERRSVKGIARNTKG
MEHLTL
Download sequence
Identical sequences A0A022QZF3
mgv1a006911m|PACid:17678486 XP_012842978.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]