SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a007035m|PACid:17691129 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a007035m|PACid:17691129
Domain Number - Region: 105-168
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a007035m|PACid:17691129
Sequence length 422
Sequence
MQNSGAKDTLLRESSNQKVHPQPMEEAANQNPEAMEALVSRIFTNISSLKSAYIQLQAAH
TPYDPDKIQAADKLVISELKNLSELKHFYRENNPKPVCVSPQDSRLAAEIQEQQSLLKTY
EVMVKKFQSEIHNKDSEILQLEQQIQEANQKRVKLEKNLKLRGLSAKESEGVNGVFSSLD
LSPDLFKSAVEAASRAIHDFSKPLINMMKAAGWDLDAAANSIEPNVNYAKRAHKKYAFES
HICQRMFVGFQDENFSMKKPEKNPIETKESFFQQYLALREMDPLDAVGQDPDSTFGIFCQ
SKYLEVLHQKMEASFFGNLDQRNYIMGGGHPRTAFYQAFLKLAKSIWLLHRLAHSFEPSV
KIFQAKRDSEFSEVYMESVVKNFILEDGDEKPKVGLMVMPGFWIGGSVIQSQVYLTGVKV
AE
Download sequence
Identical sequences A0A022QTC3
mgv1a007035m|PACid:17691129 XP_012845619.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]