SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a007976m|PACid:17675256 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a007976m|PACid:17675256
Domain Number - Region: 31-140
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a007976m|PACid:17675256
Sequence length 389
Sequence
MPISYSSEAANFTYLGSSNDKPVSQWAPHDRKEEMIMKLVPRARELQNQLQEWTEWANQK
VMQAARRLGKDKAELKTLRQEKEEVERLKKEKQTLEENTMKKLSEMENALSKASGQVDRA
NSAVRRLEVENVFLRREMEAARLRAAESAASYMEVSKREKKTLIKFQSWEKNKTVLQEDL
SAEKLKLIQMQQKLKQCKDIRDQAEAKLNQEVKAKEEILRQANSYKKEREQIEASTKSKE
SAMKSRAEANLQKSKEDIERLEKEISQLRLKPTPRNSRPQKGRSGHDLRSNWSTLEIQYT
QQRRHNNISAYIFKIVAGSTTRHVSGRETGERVRDVLVPRRCPWYFSRARTRWCALCATI
LHEKQGMKDCPFLAGGPIQRRVCVRYAHS
Download sequence
Identical sequences A0A022RTL8
mgv1a007976m|PACid:17675256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]