SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a008306m|PACid:17689292 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a008306m|PACid:17689292
Domain Number - Region: 186-289
Classification Level Classification E-value
Superfamily Tropomyosin 0.0615
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a008306m|PACid:17689292
Sequence length 378
Sequence
MRRTRAATEVATQRQSARGGPAPSSNLRTSSSDSDPPLHLRPRSERAPKLADGRSPRGGA
QSHPSNPKKLGTRIADLESQLGLAQEELKSLKDQLVVSTDSSKKSSQQDQLDKKSKKQQK
STEIEEKTPTSNTAKDGVIPYETQETDVFEVPIEKLTMEPKAEEEEEDEFKPNPVDLSEP
ENPLFNELDLKNDEISSLKATLEEKDIEMEALRLENSTLKSELDEKSVKISSAQSEINEL
TLKLTNAYEEAEKSKSSHLEMNEKLEAAEKAKEELENEMKMLRVQTEQWRKAADAAASVL
SGGVDQMNNGRRISERCGSMDKILYAHSYEHVGGYGSGGYVGSPGISDDCDDVFGSEKRK
GSSGMRMFGDLWKKKGQK
Download sequence
Identical sequences A0A022RYD2
XP_012846910.1.32330 mgv1a008306m|PACid:17689292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]