SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009181m|PACid:17680501 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009181m|PACid:17680501
Domain Number - Region: 77-179
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00497
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a009181m|PACid:17680501
Sequence length 350
Sequence
MGGIMKGGGGHMHSSSSSRRWNVYISIAVLVTVVFGCGVMGIHRIRGKRNILNLLIKEKD
DQILSLHLLLQKEREQMQEVIKEREEMKMKVYNLGGQKVELKSKLSEMQSTISSLKDELL
TIETAFQEKQNETNDQNHRIETLTETLQNKENEIEDMKQRLQLKSASNHSENGTSKNSEE
TRGENGRANIVERDEDSEARAKLQAQENPHGENLRVSGKRRSYLRRTNGKRLRVIAKQIP
GKRNNKVEERKPIIQLNESVVKDQRLRIDDSIEQGKTKVELRDYIEENNSTKPVARTNSS
TALEKAKNENYGKRDNNSSQGEKEVSEKIRDIQMESFEDSDEDRDEPDQF
Download sequence
Identical sequences A0A022QAD2
XP_012852449.1.32330 mgv1a009181m|PACid:17680501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]