SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009189m|PACid:17676710 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a009189m|PACid:17676710
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.33e-30
Family Heat-shock transcription factor 0.0017
Further Details:      
 
Weak hits

Sequence:  mgv1a009189m|PACid:17676710
Domain Number - Region: 148-197
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a009189m|PACid:17676710
Sequence length 350
Sequence
MASAFPEPPFSPFLGFGCFEPEFESKPEGLRALPHPLESLYETPIPPFLGKTFDLVDDPS
LDSIISWGKKDNSFVVWDPIEFARMILPRHFKHRNFSSFVRQLNTYVDKWEFASEGFVRG
QRHLLKNIQRRKSSQPQQQIGSSSGEEGKAAALEGEIERLRRERSSMMREVIELQHQQRG
TVERMETVNEKLHTAEKRQKQMVSFLGKIFKNPSLLSRIGQTRGQKSITTPKTMRKFVKH
QGSEPIGENKVSGTKDVSFEVEDFAQDHYLKGKAVLGPLPESMPEYFISFPDDVAKEKAA
AASMTEVEDAIWSKGFESGAGIGSSTNEFWSDVDVWDIPLQADEGYPFNE
Download sequence
Identical sequences A0A022RE10
mgv1a009189m|PACid:17676710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]