SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009351m|PACid:17697204 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009351m|PACid:17697204
Domain Number - Region: 18-191
Classification Level Classification E-value
Superfamily Tropomyosin 0.000458
Family Tropomyosin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a009351m|PACid:17697204
Sequence length 345
Sequence
MPASAERRVVPPAAAREVDPLLKDLNEKKQNFRRNVVSIAAELKEVRGRLASQEQCFAEE
TLTRQEAETKAKTMEEEMRRLQKNLEERNFQLQTSTSAVEMYVKELDDLRLQLNATKATA
EASALSAQSAQLQCSSLVKELEEKNYSLKEHEIRVKKLGEQLDLLHNDLQAREYSQTQLK
DEVSRIEHEIMQTLAKAGSNNKDSELMKILDEVSPRNFDKINKLLMVKDEEIAKLRDEIR
IMSAHWKLKTKELEYQLEKQGRADEDLRKKVLKLEFCLQEARCQNRKLQRMGERREKALK
ELRDQLAAKKTGVPTISENPNFWESPSFKIVVSMSMFILVVFSKR
Download sequence
Identical sequences A0A022R6Q0
mgv1a009351m|PACid:17697204 XP_012839823.1.32330 XP_012839824.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]