SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009455m|PACid:17677742 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009455m|PACid:17677742
Domain Number - Region: 50-132
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a009455m|PACid:17677742
Sequence length 341
Sequence
MAHGGGGGDISRVGPDFNLPDEILSVIPTDPYDQLDLARKITSMAIASRVTKLESESARL
RQKLVEKDRLVDELEDKVSQLEGAYQDAELRLKITREDNKNLVKEKDSLAMTVKKLTRDL
AKLETFKRQLMQSLNEENSPQTVDIGTYDQAPKAYSTDDDSNGYTKHHSYSWSTDSASTN
DDVTKQGGHRFSITPYITPRLTPNATPTVISTSVSPRRYSAAVSPRKTSGAASPTGQYDG
RGSLSFSSWYPSSQQSSAANSPPRGRPQPGRTPRIDGKEFFRQARSRLSLEQFTAFLTNI
KELNAQRQSREETLRKAEDIFGTDNKDLYISFQGLLNRSMH
Download sequence
Identical sequences A0A022QM49
XP_012848970.1.32330 mgv1a009455m|PACid:17677742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]