SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009553m|PACid:17685544 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009553m|PACid:17685544
Domain Number - Region: 166-252
Classification Level Classification E-value
Superfamily Xylose isomerase-like 0.0219
Family Xylose isomerase 0.044
Further Details:      
 
Domain Number - Region: 77-152
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a009553m|PACid:17685544
Sequence length 338
Sequence
MLFELAISMLGLALKPLLLAKISCQIGARSFFIIVQTWLELLKFALSLHLIVLWRLSIWA
MAALSLPIRAFNALYRERLLEMQLQRLRNELENVIWDRKDLEDKLALAIKERKMMESMLV
ELEEEHDEAIAKLELLQGEVQDLKCEIQRLNEVQGKALWSNRARAGTANDYNTPETNYNK
SSRKPHNNNNDNNKNITQVAKDLFKEEIHDVIKAGSEIYGLSISDEGYVREGQRDVALSR
SLFSAFLSLVVGIIVWESKDPCMPLVVALLTVVTISLVSVRRLFTRIEHKPASDAVLLLC
LNWFILGTLMYPTLPRIARLLVPLASCLGKRAFRWLVL
Download sequence
Identical sequences A0A022QK92
mgv1a009553m|PACid:17685544 XP_012847091.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]