SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009640m|PACid:17690988 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009640m|PACid:17690988
Domain Number - Region: 175-239
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a009640m|PACid:17690988
Sequence length 336
Sequence
MKPRTNEAPRRSRNPQGEGNNWMLIAGSALLSTLSIRLGYKLKQVFDAKQVDNSSKKLKA
NGKSADDRKKSGSCHLHSNACCFPQDEDGCYNHYPASRNAADIKQHCNSQTMSESEMVLP
LVSVPTSEFNKDNNGVMWSSSPDRLELPHKPFHQSNSSESPCVSEAGSDIFSKREVIHKL
RQQLKRRDDMVLEMQDQIAELQNSLSMQLSHSSHQQALLDSANRDLFDSEREIQRLRKAI
ADHCVGHVDKSPPSVPIWPPEGRNGHSNGYPEVESNLESSLSGEKIEMLKREVSELKELI
DGKDYLLLSYKEQKCELSVKIKELQQRLDSQLPNIL
Download sequence
Identical sequences A0A022QS11
XP_012847189.1.32330 mgv1a009640m|PACid:17690988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]