SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009765m|PACid:17695291 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009765m|PACid:17695291
Domain Number - Region: 165-246
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a009765m|PACid:17695291
Sequence length 332
Sequence
MNVEAATTNSSFNYLIKIPPTYIRVLQESFIFAIEELHVDEKTNIRDALELQVEDELPQK
EILLGYYRYVKYVEFRASCHLRSILAKRDKLLRIIDKAKNSISIEHIDSKICDLEALILE
ALMNGEFEDKQYFTREFNQLKQRREKLSSSLFDREEEKLSSLFDREEEERIRQIREAIED
AEDRLKFLEKEIQILRDSALEAEARFVKFRKKKDDAMQQIEELQRQYKVAVHACEEAIAN
KESIEKSYHDKMLLLSDCSSNGVLAHLYVASEDCVVLSRYCKNNVEKFMKRWNEDDEFRR
EYAKFNESSTITRFGSLDGARSHVSDKESPIQ
Download sequence
Identical sequences A0A022Q3V9
mgv1a009750m|PACid:17695290 mgv1a009765m|PACid:17695291 XP_012856025.1.32330 XP_012856026.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]