SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009896m|PACid:17690620 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009896m|PACid:17690620
Domain Number - Region: 214-272
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.019
Further Details:      
 
Domain Number - Region: 45-147
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00915
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a009896m|PACid:17690620
Sequence length 328
Sequence
MELPQETDDYIRGSIDDSVGLPVPSDTLLHKLRAVEASHVHLRHQYLSLQSRIKEKDEII
ERSRAESSMNAVALKKFVEENQKLASECSNLLAACNKWERECSLYDRDREALMDFANEAD
ERAKEAEIRNHDLEEEKKKLMEELQFYKFRCEGQLENAVSTDDLHVEEVLLDSLLTTLFG
KDDIGPNALSFLEAHGGLEICQKLLKMWTSLRPLTQKTVALAAEVKVLEKDKDHLKINLH
RAEDEVNVLFEENNILNEENKRLTRQCLKEKHICGSGGTSASGKGKRKSSPKMCSPVEKK
IDFGDVNTQRLPLSPLQSNSPESRMHNN
Download sequence
Identical sequences A0A022RC59
mgv1a009896m|PACid:17690620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]