SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a009990m|PACid:17682712 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a009990m|PACid:17682712
Domain Number - Region: 121-200
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00706
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a009990m|PACid:17682712
Sequence length 325
Sequence
MNQSRAISSPDLVSPSTRPEHHYDDSALEGVAANIKLLLKLTQDHKEACDKEKNDSRRML
RVATMMTILDNVRDRIQKCQSFGNIKRTSEAELRRCNTDLRRNPIPRDKRHHHGIGGEPV
VEDEKERLKRELAASLAARKSLQVMCSSLGKEKEIMACELSKKVHEMCEMEELIEHLKER
NNTLLQKVQECASEHYNERRNSGGGVGGGGGERNKVLSEQLLKSLDGYRAMKRRLKLVQE
ENVTMHGIMDEMGGKVVISIERVRRLRERMNKESEPSPGGDFRREIEALERMFERFRTLV
EKRDKNCVIQHKGEINACKPPSVLA
Download sequence
Identical sequences A0A022RWA2
mgv1a009990m|PACid:17682712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]