SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a010462m|PACid:17683711 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a010462m|PACid:17683711
Domain Number - Region: 134-220
Classification Level Classification E-value
Superfamily Tropomyosin 0.0647
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a010462m|PACid:17683711
Sequence length 311
Sequence
MAMQTGVAASKVLILVGAGVTGSVILRSGQLSDLLSHLQDLIKRLNEAETSPGKYDAALL
AAQVRQLAKEIKELSLSNPVTIFNGNSSSSGSYASYILPAAAVGAAGYCYMRWKGWSFSD
VMYVTKNNMATAVASVSKQLDHVSEALASTKRHLTKKLENLDWKLDEQREISKFICNDVT
EVKSNLNQIGFDIGLIHEMVSGLEGKIELLESKQDMTNSGLWYLCQVAGNIKDDKSSKII
QDVGAKLIDSKSTAVPGGGGAKGLQFIVGSDEPSKLQKSFSCVDAKDASAAKMRIHRSFP
VGLSFARDIVG
Download sequence
Identical sequences A0A022QQG3
XP_012846210.1.32330 mgv1a010462m|PACid:17683711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]