SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a010485m|PACid:17677128 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a010485m|PACid:17677128
Domain Number - Region: 153-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a010485m|PACid:17677128
Sequence length 311
Sequence
MSEIVVGGSDPPSPPLSVASSESSKSSGNTGFDTNRIAEVKAWLVSQFDAAGKDVPEFEY
TPRSISHLHNIATLSQAKTQAATIVANDFRQKAIEYRSQAARIREILEHVGLVQESLPSN
VVSSSQVLASVANLLNIRDTELSSFLVAMADISLRKTAVEEKRAKVQQESKELLDYTRKA
IARLTYLKRTFAQLEDDIPPCEAQMEHWKTNLTIMESKERQYLQQYSNYKAMLNRAGYSP
EISHGVLVEMAEHKKDLEKKTKPILDTLRSYQDLPPDKALAALAIEDKKRQYTAAEKYLE
DVLQSALASSE
Download sequence
Identical sequences A0A022PWP3
XP_012857430.1.32330 mgv1a010485m|PACid:17677128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]