SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a010911m|PACid:17693342 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a010911m|PACid:17693342
Domain Number 1 Region: 92-241
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000595
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a010911m|PACid:17693342
Sequence length 298
Sequence
MADETVINGDFSNDRAVEITGEEEASSKISVLTQKITDLELENKKNIQQNEGYKQEIEEL
KASVRELSGANVEWKNKFEKAESEIKTLGSVAARAAELEIDVSRLHHDLVSAVSDLQENT
VEVSNLKKELEGAKEREKDKDVKLEVIGKERDLLLAKVEKLEGFETSLRDESDVKEKEIR
GLKKKIEELAGIVDICKNLEKVRQALESSIVKMKGEITILENSLKEKNNVIRVFETKARE
VDEIVNRDLGLNNGGEKKKGLIIGGLKQKDWVLVGGSTFAAVAVMGVACYVHAAAKKH
Download sequence
Identical sequences A0A022QQN1
mgv1a010911m|PACid:17693342 XP_012846743.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]