SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a011758m|PACid:17697095 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a011758m|PACid:17697095
Domain Number - Region: 101-144
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a011758m|PACid:17697095
Sequence length 271
Sequence
MKEQCLAVKHGEKNTSSFAGPTGTKLQPPKAPVADPQKGGSPPKRPRCSSKDPKKILQCM
RESAFQRDKEIVSEMSPEEHCAQIAYHTAKLSAMATARRSDRTRALEEERRKAVEEVESF
KAKCSSLEDEVARTKEELAKSVKKNESVRAKSYNKGFSDLVRSTEFRHVMELYAEALMNA
YRNSTLFLSKLAEVARFNYLEAFGLCQEKIRKAGSDLVLDPIACMDKLTVEDLPAHDWNG
NPDEPVDYPWWDGIYEKVVDDYFKEKKASGS
Download sequence
Identical sequences A0A022QAH4
mgv1a011758m|PACid:17697095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]