SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a012144m|PACid:17673642 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a012144m|PACid:17673642
Domain Number - Region: 102-206
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a012144m|PACid:17673642
Sequence length 260
Sequence
MMPRYPISYRGAHEDPRSFMLRGPPPLPHPHPAHLEEELDLQQRDIQRLLSENRRVVDDN
VMLQRDLAAVKDEIHRLNQSVIPKLQGESGTHRRELVERGLSLEAQLRSAEPLRKEVVQL
RDEAKKSSSQRQDLSAQVQNLEKDVGKLQTENKKVASMKSDIDKMRKDVVDARRIFEYEK
KGNEELVEQNRAMEKNLISMAREIEQLRAEQASADRRAIGARGYGMMDGSPETRYPGPYG
DVYGAGPWGTYDKLGPPPRR
Download sequence
Identical sequences A0A022QMR2
XP_012846195.1.32330 mgv1a012144m|PACid:17673642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]