SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a012602m|PACid:17692026 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a012602m|PACid:17692026
Domain Number - Region: 7-17,96-149
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000188
Family Formin homology 2 domain (FH2 domain) 0.055
Further Details:      
 
Domain Number - Region: 125-204
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a012602m|PACid:17692026
Sequence length 245
Sequence
MAEEGAPPPPPPPPPTPSPSQTQAWRSYISEDLPRSVQQSADSAIRSARSLQESSSTHLR
SIQDFVPQIGTRYRYYEDAFIHKVKDELMTLKEHPALAGGVAVTAFFLLMPGPRRFLFRQ
TLGRLQSEEAQFVKAENNVKELTLSVDIMKKESKKLLERSVLAEKDMKRGHSDLMGAGTE
IQSLARSVYKTETKAADLMDLLREIPGREALKLRADVASMASHLRQQRSAMDRRILKISE
LGVPV
Download sequence
Identical sequences A0A022QZ02
XP_012843059.1.32330 mgv1a012602m|PACid:17692026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]