SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a012648m|PACid:17691001 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a012648m|PACid:17691001
Domain Number - Region: 42-87
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00602
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a012648m|PACid:17691001
Sequence length 244
Sequence
MEDQCSPLSWAYYYQEEGVEELKQSLFYSTLELESAVLAAHEEISRKDDEILQLNNLIAK
IIKERDEFEAKCQNLVVEKQLLSQQVQIHNLEYCCPNNYSSGSITSNNDNIALSPSDCDD
TLPPTAPRMILDVADGITLKRPLPENGKFLQAVMEAGPLLQTLLLAGPLPRWQHPPPKLN
SGDIPPVTISSPAAAAAKILHHQDSCRLVSPSGGFTNKRAMVNMDKDLDFSPISKFQKVC
SPIN
Download sequence
Identical sequences A0A022RL68
XP_012834575.1.32330 mgv1a012648m|PACid:17691001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]