SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a012808m|PACid:17693957 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a012808m|PACid:17693957
Domain Number - Region: 146-218
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0022
Family Myosin rod fragments 0.02
Further Details:      
 
Domain Number - Region: 42-133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0212
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a012808m|PACid:17693957
Sequence length 239
Sequence
MLKGRKPVGRETMAAHYAFGPLEDDIIIKHRLLTRTTTTRGEPPLKKLQKKFTAFATEVE
KEAENYGDCERLAKSFLQELNTFEIPLLKSRAVIDANVREKENFNELKYEINRQISQAHG
DIEDLKKQLEESKIERQHKEECEAIRKLIAMQPPRSETQKTITDLEKEIAMLEAENTAGS
RTLDLRKKQFALLLHVVDELQNTIEEEQRSLMEEMRTAVDEHRTGLEDANGGPEAMALD
Download sequence
Identical sequences A0A022S1E6
XP_012836824.1.32330 mgv1a012808m|PACid:17693957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]