SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a013250m|PACid:17690002 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a013250m|PACid:17690002
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000246
Family Transcription factor E/IIe-alpha, N-terminal domain 0.088
Further Details:      
 
Weak hits

Sequence:  mgv1a013250m|PACid:17690002
Domain Number - Region: 131-194
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0133
Family 14-3-3 protein 0.016
Further Details:      
 
Domain Number - Region: 79-139
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a013250m|PACid:17690002
Sequence length 226
Sequence
MAPKSDSAEGIVLNFVNEHNKPLNSQNVADSLQKFNLKKAAVQKALDSLADSGKISFKEY
GKQKIYLARQDQFDIPNNEELNQMKEENAKLQEQLAEGKKAIAEVEGEIKALQTNLTLEE
IHARQIQLGDEVNQMEERLIKLRQGVTLVTPEERQAVEKIYTNMINQWRRRKRMFKDVWD
AITENSPKNPKEFKEELGVEYDEDVGVSLQSFGELVQTGRKRTRCN
Download sequence
Identical sequences A0A022RLH1
XP_012833194.1.32330 mgv1a013250m|PACid:17690002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]