SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a013781m|PACid:17674307 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a013781m|PACid:17674307
Domain Number - Region: 87-155
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0217
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a013781m|PACid:17674307
Sequence length 210
Sequence
MGASESSLASSQNPEDGITTVSERTNGVDPILQKLQSLQITKPILTSAPAESTLTDILVR
KPFSSSTSGSVNPNVLLELFSTYRNWQEENVQNISKRQEEIENKIEVADALAVKLLKRFN
YSVSAIKTTSNHLSEVHGLQVELGELKGRLTEVISNCDALCKRIVNEGPESLQSSVEPLT
AAASTNHNSLSLLPSLPSSQEEDRLSQESS
Download sequence
Identical sequences A0A022PXI3
mgv1a013781m|PACid:17674307 XP_012857688.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]