SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a013901m|PACid:17683292 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a013901m|PACid:17683292
Domain Number 1 Region: 13-78
Classification Level Classification E-value
Superfamily Homeodomain-like 2.38e-16
Family Homeodomain 0.0054
Further Details:      
 
Weak hits

Sequence:  mgv1a013901m|PACid:17683292
Domain Number - Region: 69-122
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0068
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a013901m|PACid:17683292
Sequence length 207
Sequence
MNNLPQNPKNHSHRAQKKRLSQEQVRLLEASFDAAKKLEPEHKFQLARQLGVPPRQIAIW
YQNKRARWKNQSLELDCGSLQVRLEAAEAEKERLERQVASLRGELKRAQDSLSGFRQLAA
AQAPPVSSLSSTCCDEGGGSSSLNDDVGCSANWANGGGGGGAGDALQFEELYACLMLGAG
KGSNTCGPITDQIYGVNERDFNFGYNI
Download sequence
Identical sequences A0A022RY58
mgv1a013901m|PACid:17683292 XP_012848848.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]