SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a013956m|PACid:17671015 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a013956m|PACid:17671015
Domain Number 1 Region: 61-123
Classification Level Classification E-value
Superfamily Homeodomain-like 2.99e-18
Family Homeodomain 0.0051
Further Details:      
 
Weak hits

Sequence:  mgv1a013956m|PACid:17671015
Domain Number - Region: 114-163
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a013956m|PACid:17671015
Sequence length 205
Sequence
MVLISQYYPDGMYNNHHFVPEQTGGGAAAGVVNSKPRRRRKKNKGGGGDEGCGGVEGMLR
KRKLSEEQVNMLERSFGSEHKLESERKDKLAAELGLDPRQVAVWFQNRRARWKSKKLEEE
YSKLKAEHESTVVKNCHLETELLKLKEQLNEANRAIQMLSEQRSDGFSSNSPSSSFSMEG
LGNVFYAAENNYFHGMEWDNNIYYM
Download sequence
Identical sequences A0A022RX81
mgv1a013956m|PACid:17671015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]