SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a014134m|PACid:17682076 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a014134m|PACid:17682076
Domain Number 1 Region: 124-187
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000151
Family Cystatins 0.024
Further Details:      
 
Weak hits

Sequence:  mgv1a014134m|PACid:17682076
Domain Number - Region: 24-78
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00889
Family Myosin rod fragments 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a014134m|PACid:17682076
Sequence length 199
Sequence
MTFRGSTGGGIKVSILHGGDSVMEKYPETKKRINKMRKQLEKFEVENPEQRNRITKIRRH
LDKLINKLEEEDEEKEEEVLDEISNCYWKPDVQPTPIRRRLSDMVLYDRRDSTASTYPNR
MRLLKNTAKLAIGYFNKQSPIRYSVLDLVRATQHVCAGRYFRLTFTAKPEGSEETETFEA
KVCYRIGQIDVDFVKIVAT
Download sequence
Identical sequences A0A022RDE8
XP_012838113.1.32330 mgv1a014134m|PACid:17682076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]