SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a018165m|PACid:17677444 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a018165m|PACid:17677444
Domain Number 1 Region: 25-92
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a018165m|PACid:17677444
Sequence length 116
Sequence
MAGSDSQRQLLTLIRDFSTEKSQGERRIVNQKKRIEDLTSELDVLNKELEEAKRDKETIE
QDLKGYEVELSMIDASIQALEARVALTNNEISKLGSEMAALKRWIYCKNARAKFTD
Download sequence
Identical sequences A0A022R3F0
mgv1a018165m|PACid:17677444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]