SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a018254m|PACid:17688635 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a018254m|PACid:17688635
Domain Number - Region: 15-233
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a018254m|PACid:17688635
Sequence length 249
Sequence
MAGKLQIAHVNLVASNNREEQANSKLRDFENRLNEKEALISKLLNDNAEVTDLRENVRML
EEKAANLTELNIELTEELDFVKGNNDSNTKKASLLEKQLREFDVQLQHSRALSEASQEQQ
NMLYSAIWDMETLIDELKQKVGKAENVAENAEEKCVVLSEKNSEMSSRMESMEESLEKAS
LEKKSCVNEISIRTSVIMEMVTELAIERERIEKQLISLTKENKLLRGKLANKKNNASVVL
TDNRINVKE
Download sequence
Identical sequences A0A022Q4N5
mgv1a018254m|PACid:17688635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]