SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a018759m|PACid:17687934 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a018759m|PACid:17687934
Domain Number - Region: 141-191
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a018759m|PACid:17687934
Sequence length 452
Sequence
RPNKTSSRIAKTFQKVIHLKTATRNNRSRNPGFCLLIPQEKLRCCESHLQFETEDAEEAR
EEFKNRAAMAAFVAKLFATVSAVKAAYAELQMAQFPYSDEAVQSADQSVVDELKSLSEMK
YSFLKKQIDSSPPHVTVMLAEIREQQSLMKTYEITMKKMQGEIENKENQISSLQQKLQEI
VQSNKSLEKKMNASGSFSILDNVKFSEVNPKDFVLVLHYCLRSVRNFVKLLIREMESADW
DIEAAANSALQKNDVVFVKRDHKAFAFESFVCREIFGGFNDPGFSLQSKSSLSGDNIHQR
RVFFFEEFKKLRSVGVVHFLKRNPNSLFGKFLKSKYLQLVHPKMEFSFSGNLNQRKMVNS
GEFPETEFFKSFAEMGRRVWLLHCLAFSFGQEVGIFQVERDSKFSDVYMESVTEDVFAAA
DGGFRVAFTVVPGFEVGRTVVQSQVYLLPARN
Download sequence
Identical sequences A0A022QHE4
mgv1a018759m|PACid:17687934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]