SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a019715m|PACid:17674906 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a019715m|PACid:17674906
Domain Number - Region: 459-661
Classification Level Classification E-value
Superfamily Tropomyosin 0.00262
Family Tropomyosin 0.0034
Further Details:      
 
Domain Number - Region: 271-461
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number - Region: 28-105
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.0549
Family Domain of the SRP/SRP receptor G-proteins 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a019715m|PACid:17674906
Sequence length 811
Sequence
MDALCEELDRAKDEIENLKEQCRAKAELAESLRRAHNDQLSKDKETSSKLEKLAHELTEK
DGGFCAVKQMYEELKSSSTQKESIIKNLTCLNEKLRSEFTEKLRKCEEENKALASALDDS
NAKNTDQEKQIRGLKDEIEGVKKLLAFSEKKCLEAENNTEASKELKVREDGFFKLQEEKR
KVEDELKWKKEQFCHLEEAHDKLRNQLRTREIEWENKEAMALALDNANSKIFDQEQQISA
LEHEIKGFKKILDFSEDKSENKTKGLKGRDENAFLKLEEEKKKFEDQLKWKKEQFVHLEE
AHEKLRNQLKTKEKEWEKEKASLLDGIASLQTNLESQTRILHDLQSRFEMCNQALAHAEG
KRKLLEAQLSESKTSFDSVCAEYDVAKSNFESFNAKRDQEIASLRSSLSTKDILYKEMEY
QFKKVDQEKQECLVLVKELQEAQIREAGFSSCSKLQSKIKFLERAHMGCSTNLKEKESEL
EKLSEELSVCRSALKNRDNSLNELKKELDACDSVILNLELINQETSLALLVLKSEFSENI
YELVEKLEQKKDALSLVQQDLEGEREKVSILLRKVEALEQVQVLLQKEVNRLEEMLEEST
KSQLLSEEQVLQIQSDLRKVNSALDRANEELYERFCEANEIEFELMMWKSSAEKLEENLE
RNVLMRREVEASLIAQVEVEVNLKQEIEENEKRINDLQQKLLEEKDERIYDLQKLVGTLE
EEFENSSNSFSCRLSQVQKESILFRESWEKIKTNAVLNEVEIQEKNLVIVELENDLLQQE
RKACLDNNEKKIREIEEVEEVEELKKKNEKL
Download sequence
Identical sequences A0A022RK80
mgv1a019715m|PACid:17674906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]