SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a019743m|PACid:17690848 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a019743m|PACid:17690848
Domain Number - Region: 22-103
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a019743m|PACid:17690848
Sequence length 398
Sequence
MLGLKKAYADVLFNISKEAAARVMSSEKKAAQYQNELKTSKDEALRMLMRLKQMMDSKTS
EAEAASLSQQSKIDELEAQLQEAEDIVKDLREELEEAHSQLERAKRGNSHHHANEPKNLS
LREPGARIYEAAIASYISNPDLLPSIISRPKDPGLYRNGCTQRIRACERNSVETDKGMDK
DNNSNKNNKRESEEDEEKVPSTKTKTLSELEEKLMADSNCRSFLQKKKRANRLRKVVKIS
SVNVDVSVSDKDGGGGAGQSRTARTMSEDSLGDERKAVKAFGGGGSTVLQKDEGLKRKTV
DVEKVDVSGANSSYTTVGERVIKYTFQRKRKREALSGGEVKTSVEAEKETEVKKTGDQKM
GDQETSDQKTEQSKSSLLSMESSRESRRLAQVARQVSV
Download sequence
Identical sequences A0A022RUA2
mgv1a019743m|PACid:17690848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]