SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a019835m|PACid:17679840 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a019835m|PACid:17679840
Domain Number 1 Region: 244-632
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.35e-96
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily PH domain-like 6.44e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 631-702
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.34e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  mgv1a019835m|PACid:17679840
Domain Number - Region: 843-912
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a019835m|PACid:17679840
Sequence length 1074
Sequence
AITALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIVSGQRTP
IFQRYPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFSGLKALISRGHQRKWRTETRSD
GISSGANSPRAYTRRSSPLNSPFGSDSLQKDGAGQLRLHSPYDSPPKNGVDKAFSDVVLY
AVPPKVFFPSDSASASVHSISSGGSDGMHGHMKGMGVDAFRVSLSSAVSSSSQGSGHDDG
DALGDVFMWGEGTGDGTVGGGLQRVGSSLGVKMDSLLPKALESAVVLDVQNIACGGRHAS
LVSKQGEIFSWGEELGGRLGHGVDSDVLHPKLIDALSNTNIELVACGEYHSCAVTLSGDL
YTWGDGHFGILGHGNEVSHWVPKRVNGPLEGIHVSSISCGPWHTAVVTSAGQLFTFGDGT
FGVLGHGDRDSVSKPREVESLKGLRTVRAACGVWHTAAVVEVMVGSSSSSNCSSGKLFTW
GDGDKGRLGHGDKEPKLVPTCVAALVEPNFCRVACGHSLTVALTTSGHVYTMGSPVYGQL
GNPQADGKLPSRVEGKLVKSFVEEIACGAYHVAVLSSRTEVYTWGKGANGRLGHGDVDDR
NSPTLVEALKDKQVKSIACGTNFTAAICLHKWVSGVDQSMCSGCRLPFNFKRKRHNCYNC
GLVFCHSCSNKKSLRASMAPNPNKPYRVCDNCFNKLKKAIETDTSSHSSISRRGNMNQGT
SDVADKDDSRSRPQLTRFSSMESLKQGEIRSSKKNKKLEFNSSRVSPIPNGSSQWGASKS
FNPVFGSSKKFFSASVPGSRIVSRATSPISRRASPPRSTTPTPTLGGLASPKLVMDDVKM
TNDGLSQEVIKLRAQVEGLTRKAQLQETELERTTKQLKEAIAVAGEESAKCKAAKEVIKS
LTAQLKEMAERLPVGSARNIKSPPFTPLSPPLLNDVSNVSIDLPNGQINGQELQPYESNN
LLSNGSSTASNRSSVQSRQGSQTEAVMRNGNRTKESDSRNETEWVEQDEPGVYITLTSLA
GGLKDLKRVRFSRKRFSEKQAEQWWAENRARVYQVYNIRMVDKSSVGVGSKDLG
Download sequence
Identical sequences A0A022R7J9
mgv1a019835m|PACid:17679840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]