SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a020225m|PACid:17686651 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a020225m|PACid:17686651
Domain Number 1 Region: 9-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-35
Family Heat-shock transcription factor 0.00061
Further Details:      
 
Weak hits

Sequence:  mgv1a020225m|PACid:17686651
Domain Number - Region: 114-183
Classification Level Classification E-value
Superfamily Tropomyosin 0.0379
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a020225m|PACid:17686651
Sequence length 411
Sequence
MDEAQCSSNSLPPFLAKTYEMVEDPSSDSVVSWSWNNKSFIVWNPPEFSRDLLPRFFKHN
NFSSFIRQLNTYGFRKVDPEQWEFSNEDFVRGQPHLLKNIHRRKPVHSHSAPNLASLPPL
TEMERKSYKEDIEKLRNDKESLHVELQRHKDEQQCLKSQMRILSERVQNVENRHSNMLSS
LAQTLHKPASSLDLMPQGEVHDRKRRFPGNSYLCEETNMEDNNNNNNNNNNNNQRAASQR
STIEKLDANSLLNFNKELLEQLESSLMFWEKIVFDVGDGLVQRNSSSELVESTSCGPSPS
ISYTQLDLDVGIDMNSEPKTAFGLELQPRTEEQAVEVATNVRTGVNDVFWEQFLTENPGS
NDSSEFQTGQAETESKKNENKPSDRGMYWWNMKSVNNLAEQLGHLAPAERT
Download sequence
Identical sequences A0A022QKL3
mgv1a020225m|PACid:17686651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]