SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a020685m|PACid:17691217 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a020685m|PACid:17691217
Domain Number - Region: 244-338
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0167
Family Myosin rod fragments 0.0086
Further Details:      
 
Domain Number - Region: 637-687
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0241
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 321-429
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a020685m|PACid:17691217
Sequence length 718
Sequence
SSNSNSRDDKASVGRIDEVVRESHRSRERRTAEIGKNSNIMLHAEIESKVKRTLKLAKNI
NNNKDANMKKKSELIHLVEDFHHHYESLYSMYEDLRGEVKNNVRFEDNASSSSSSSSSPP
DSEAYYSPVERIVKNDENTPDQIYNINQESETSDVEDTTILKDKLTSSSEVKEASTFGSK
SQEFNEILEDLTMEEKEEERENTRKKLDQMRDLEATVVDLKIEVETLCTHRRALEEQIVF
KCNETTQMQEKISRLESRISEQEENEKDFLSKISDFVEKNKILHLEKGELEEIAKERCDQ
VKGLTEQVNSLKIHKSELELELKKKSAEISECVHQIENPTNEDTIEDDGSLKVNKVINDL
EIEVRSLSSKNKELEDEIKRINHEAKEQRGKISELKTSLSVKENELSTQQKKHKAIQNDL
SAKIELLNENIKNHEKKSEALLKDKDELEKEKREFITSKSQLEKKNTELIKKISDQQKTL
LELGEAMSKIKQENEDAQTKILLGSKSNINFVERKVEEMAEEFRKQFEDKYRILSRRIRV
AEQLHVENKEWYLKTKDAYEQETKELKERFKDVTDMSVTANDFLVSLDSLALKFEECNAN
FMNRISKSSCELKFAKDWARRKNKALVHVKEDLDCLLIQLDDKEGEILVYREKVWKLENK
VRELEKVIKEREDGMLGLQEEKREAIRQLCVWIDYHRSRSDYYMKMLSEINPGRRKSS
Download sequence
Identical sequences A0A022RJ68
mgv1a020685m|PACid:17691217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]