SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a021123m|PACid:17683042 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a021123m|PACid:17683042
Domain Number - Region: 60-129
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a021123m|PACid:17683042
Sequence length 314
Sequence
MAYGGGDVGPCFNLPDEILSVMPTDPYEQLDLARKITSMAIASRVTNLEAEAVGLRQKLR
EKDRLIQELEDKASRLEGACQDAELRFRIAIEDNMKLLKEKESLDLNVKKLNRDLAKLET
FKRQLMQSLNDENSPQTETVDIGTYDQSTPKKYSEPAPKLVQRFPFTPYQKTRVTQTGTP
KLITSVELPHNRAYSSAGSPQGMSAPASPRTQYEGSGSFSSCFPSSQLSSATNSPPRGRQ
LSARSPRINGKEFFRQVRSRLSLDQFTAFLTNIKELNAQKQSREETLRKAEEIFGVDNKD
LYISFQGLLNRSNQ
Download sequence
Identical sequences A0A022R4M1
mgv1a021123m|PACid:17683042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]